Web stats for Tatianescremin - tatianescremin.com.br
2.20 Rating by ClearWebStats
tatianescremin.com.br is 7 years 5 months 3 weeks old. This website is a sub-domain of com.br. This website has a #1,787,495 rank in global traffic. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. While no active threats were reported recently by users, tatianescremin.com.br is SAFE to browse.
Traffic Report of Tatianescremin
| Daily Unique Visitors: | 269 |
| Daily Pageviews: | 538 |
Estimated Valuation
| Income Per Day: | $ 2.00 |
| Estimated Worth: | $ 480.00 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | 1,787,495 |
| Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is tatianescremin.com.br server located?
Hosted IP Address:
187.45.189.111
Hosted Country:
BR
Location Latitude:
-22.8305Location Longitude:
-43.2192Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | 8 | H2 Headings: | 21 |
| H3 Headings: | 3 | H4 Headings: | 10 |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 24 |
| Google Adsense: | Not Applicable | Google Analytics: | UA-91463351-1 |
Websites Hosted on Same IP (i.e. 187.45.189.111)
Deus é Mais - Entretenimento, Curiosidades Bíblicas, Estudos, Devocionais
Entretenimentos, curiosidades bíblicas, devocionais
Not Applicable 
$ 8.95
O que é ITIL | Mundo ITIL
Entenda o que é ITIL V3, sua importância no gerenciamento de serviços de TI (ITSM) e os principais benefícios de sua implementação em uma empresa.
1,160,750 $ 720.00
HTTP Header Analysis
HTTP/1.1 200 OK
Server: openresty
Date: Wed, 05 Jun 2019 00:14:22 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.6.40
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://tatianescremin.com.br/xmlrpc.php
Link: <http://tatianescremin.com.br/wp-json/>; rel="https://api.w.org/", <http://tatianescremin.com.br/>; rel=shortlink
Content-Encoding: gzip
Server: openresty
Date: Wed, 05 Jun 2019 00:14:22 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.6.40
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://tatianescremin.com.br/xmlrpc.php
Link: <http://tatianescremin.com.br/wp-json/>; rel="https://api.w.org/", <http://tatianescremin.com.br/>; rel=shortlink
Content-Encoding: gzip
Domain Information for tatianescremin.com.br
| Domain Registrar: |
HUNIC
|
|---|---|
| Registration Date: | 2016-10-23 7 years 5 months 3 weeks ago |
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| tatianescremin.com.br | A | 3599 |
IP:187.45.189.111 |
| tatianescremin.com.br | NS | 21599 |
Target:ns3.weblink.com.br |
| tatianescremin.com.br | NS | 21599 |
Target:ns4.weblink.com.br |
| tatianescremin.com.br | NS | 3599 |
Target:ns1.weblink.com.br |
| tatianescremin.com.br | NS | 21599 |
Target:ns2.weblink.com.br |
| tatianescremin.com.br | SOA | 21599 |
MNAME:ns1.weblink.com.br RNAME:hostmaster.tatianescremin.com.br Serial:2017101504 Refresh:28800 Retry:7200 Expire:604800 |
| tatianescremin.com.br | MX | 3599 |
Priority:10 Target:mx1.weblink.com.br |
| tatianescremin.com.br | TXT | 14399 |
TXT:v=spf1 include:servers.mcsv.net ?all |
| tatianescremin.com.br | TXT | 14399 |
TXT:v=spf1 include:spf.mx.hostinger.com include:relay.mailchannels.net ~all |
Similarly Ranked Websites to Tatianescremin
Home | SR Tech Services - UAE
SR Tech Services is a company established in UAE providing installation, renovation and maintenance services on Elevators, Escalators, Central A/c and Automatic doors.
1,787,503 $ 480.00
Homebrew Equipment Deals
Find the best home brewing supplies and the best gifts for beer lovers.
1,787,508 $ 480.00
WordPress.com — Buradan Ücretsiz bir Blog alın
- kocaelizmitsatilikarsadairevfiyatlari.wordpress.com
sahibinden satılık kocaeli izmit arsa, daire, konut, ev, villa, yat, tekne fiyatları başiskele, çayırova, darıca, derince, dilovası, gebze, gölcük, izmit, kandıra, karamürsel, kartepe, körfez bulabilirsiniz.
1,787,508 $ 480.00
Buy Handmade Shoes,Bags,Accessories Online for Men & Women | Kethini
Kethini,makers of hand made shoes,bags,accessories for men & women,aims to cater the young urban Indian consumer needs by offering the highest quality stuff with innovative material and fresh new designs.
1,787,508 $ 480.00